TNNI3K antibody (70R-3960)

Rabbit polyclonal TNNI3K antibody raised against the N terminal of TNNI3K

Synonyms Polyclonal TNNI3K antibody, Anti-TNNI3K antibody, TNNI3K, CARK antibody, MGC33828 antibody, TNNIK 3, TNNIK-3, TNNIK-3 antibody, MGC142099 antibody, TNNIK 3 antibody, Tnni3 Interacting Kinase antibody
Specificity TNNI3K antibody was raised against the N terminal of TNNI3K
Cross Reactivity Human
Applications WB
Immunogen TNNI3K antibody was raised using the N terminal of TNNI3K corresponding to a region with amino acids LLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNAQDNED
Assay Information TNNI3K Blocking Peptide, catalog no. 33R-5154, is also available for use as a blocking control in assays to test for specificity of this TNNI3K antibody


Western Blot analysis using TNNI3K antibody (70R-3960)

TNNI3K antibody (70R-3960) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 103 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TNNI3K antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TNNI3K may play a role in cardiac physiology.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TNNI3K antibody (70R-3960) | TNNI3K antibody (70R-3960) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors