TNRC6B antibody (70R-4949)

Rabbit polyclonal TNRC6B antibody raised against the N terminal of TNRC6B

Synonyms Polyclonal TNRC6B antibody, Anti-TNRC6B antibody, TNRC6B, Trinucleotide Repeat Containing 6B antibody, KIAA1093 antibody, TNRCB-6, TNRCB 6, TNRCB-6 antibody, TNRCB 6 antibody
Specificity TNRC6B antibody was raised against the N terminal of TNRC6B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TNRC6B antibody was raised using the N terminal of TNRC6B corresponding to a region with amino acids YVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAV
Assay Information TNRC6B Blocking Peptide, catalog no. 33R-10284, is also available for use as a blocking control in assays to test for specificity of this TNRC6B antibody


Western Blot analysis using TNRC6B antibody (70R-4949)

TNRC6B antibody (70R-4949) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 183 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TNRC6B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TNRC6B is involved in the binding of RNA and nucleotides.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TNRC6B antibody (70R-4949) | TNRC6B antibody (70R-4949) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors