TOR1B antibody (70R-1899)

Rabbit polyclonal TOR1B antibody

Synonyms Polyclonal TOR1B antibody, Anti-TOR1B antibody, TORB 1, DQ1 antibody, Torsin B antibody, Torsin Family 1 Member B antibody, TORB 1 antibody, TORB-1 antibody, TOR1B, MGC4386 antibody, TORB-1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TOR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID
Assay Information TOR1B Blocking Peptide, catalog no. 33R-9534, is also available for use as a blocking control in assays to test for specificity of this TOR1B antibody


Western Blot analysis using TOR1B antibody (70R-1899)

TOR1B antibody (70R-1899) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TOR1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TOR1B may serve as a molecular chaperone assisting in the proper folding of secreted and/or membrane proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TOR1B antibody (70R-1899) | TOR1B antibody (70R-1899) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors