Transglutaminase 5 antibody (70R-2264)

Rabbit polyclonal Transglutaminase 5 antibody raised against the C terminal of TGM5

Synonyms Polyclonal Transglutaminase 5 antibody, Anti-Transglutaminase 5 antibody, Transglutaminase -5 antibody, Transglutaminase 5, TGM6 antibody, Transglutaminase 5 antibody, TGMX antibody, Transglutaminase 5, Transglutaminase -5, TGX antibody, TGM5 antibody, MGC141907 antibody
Specificity Transglutaminase 5 antibody was raised against the C terminal of TGM5
Cross Reactivity Human
Applications WB
Immunogen Transglutaminase 5 antibody was raised using the C terminal of TGM5 corresponding to a region with amino acids VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
Assay Information Transglutaminase 5 Blocking Peptide, catalog no. 33R-9671, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 5 antibody


Western Blot analysis using Transglutaminase 5 antibody (70R-2264)

Transglutaminase 5 antibody (70R-2264) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TGM5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TGM5 belongs to the transglutaminase superfamily, transglutaminase family. It catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. It contributes to the formation of the cornified cell envelope of keratinocytes. Defects in TGM5 are a cause of peeling skin syndrome acral type (APSS).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Transglutaminase 5 antibody (70R-2264) | Transglutaminase 5 antibody (70R-2264) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £272.51
Size: 50 ug
View Our Distributors