Transglutaminase 6 antibody (70R-1947)

Rabbit polyclonal Transglutaminase 6 antibody raised against the middle region of TGM6

Synonyms Polyclonal Transglutaminase 6 antibody, Anti-Transglutaminase 6 antibody, Transglutaminase -6 antibody, TGY antibody, Transglutaminase 6, TGM6 antibody, TGM3L antibody, Transglutaminase -6, Transglutaminase 6 antibody, dJ734P14.3 antibody, Transglutaminase 6
Specificity Transglutaminase 6 antibody was raised against the middle region of TGM6
Cross Reactivity Human,Mouse
Applications WB
Immunogen Transglutaminase 6 antibody was raised using the middle region of TGM6 corresponding to a region with amino acids KKIGRCISTKAVGSDSRVDITDLYKYPEGSRKERQVYSKAVNRLFGVEAS
Assay Information Transglutaminase 6 Blocking Peptide, catalog no. 33R-4473, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 6 antibody


Western Blot analysis using Transglutaminase 6 antibody (70R-1947)

Transglutaminase 6 antibody (70R-1947) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TGM6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TGM6 belongs to the transglutaminase superfamily and catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Transglutaminase 6 antibody (70R-1947) | Transglutaminase 6 antibody (70R-1947) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors