Transglutaminase 7 antibody (70R-2336)

Rabbit polyclonal Transglutaminase 7 antibody raised against the C terminal of TGM7

Synonyms Polyclonal Transglutaminase 7 antibody, Anti-Transglutaminase 7 antibody, Transglutaminase 7, Transglutaminase -7 antibody, Transglutaminase 7, TGMZ antibody, Transglutaminase 7 antibody, TGM7 antibody, Transglutaminase -7
Specificity Transglutaminase 7 antibody was raised against the C terminal of TGM7
Cross Reactivity Human
Applications WB
Immunogen Transglutaminase 7 antibody was raised using the C terminal of TGM7 corresponding to a region with amino acids TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVE
Assay Information Transglutaminase 7 Blocking Peptide, catalog no. 33R-9245, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 7 antibody


Western Blot analysis using Transglutaminase 7 antibody (70R-2336)

Transglutaminase 7 antibody (70R-2336) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TGM7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Transglutaminases (TGM; EC are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilonlysine crosslinks. Transglutaminases (TGM; EC are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon lysine crosslinks.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Transglutaminase 7 antibody (70R-2336) | Transglutaminase 7 antibody (70R-2336) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors