Transportin 2 antibody (70R-2301)

Rabbit polyclonal Transportin 2 antibody

Synonyms Polyclonal Transportin 2 antibody, Anti-Transportin 2 antibody, Transportin -2, TNPO2 antibody, Importin 3 Karyopherin Beta 2B antibody, Transportin -2 antibody, IPO3 antibody, KPNB2B antibody, Transportin 2, Transportin 2 antibody, TRN2 antibody, FLJ12155 antibody, Transportin 2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Transportin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDWQPDEQGLQQVLQLLKDSQSPNTATQRIVQDKLKQLNQFPDFNNYLIF
Assay Information Transportin 2 Blocking Peptide, catalog no. 33R-5883, is also available for use as a blocking control in assays to test for specificity of this Transportin 2 antibody


Western Blot analysis using Transportin 2 antibody (70R-2301)

Transportin 2 antibody (70R-2301) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 100 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TNPO2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Transportin-2 (TNPO2) mediates nuclear import of HuR protein in vitro. It also participates in mRNA export from the nucleus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Transportin 2 antibody (70R-2301) | Transportin 2 antibody (70R-2301) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors