TRAPPC1 antibody (70R-3979)

Rabbit polyclonal TRAPPC1 antibody raised against the middle region of TRAPPC1

Synonyms Polyclonal TRAPPC1 antibody, Anti-TRAPPC1 antibody, TRAPPC1, TRAPPC-1 antibody, BET5 antibody, Trafficking Protein Particle Complex 1 antibody, TRAPPC 1, TRAPPC-1, MUM2 antibody, TRAPPC 1 antibody
Specificity TRAPPC1 antibody was raised against the middle region of TRAPPC1
Cross Reactivity Human
Applications WB
Immunogen TRAPPC1 antibody was raised using the middle region of TRAPPC1 corresponding to a region with amino acids YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM
Assay Information TRAPPC1 Blocking Peptide, catalog no. 33R-10152, is also available for use as a blocking control in assays to test for specificity of this TRAPPC1 antibody

Images

Western Blot analysis using TRAPPC1 antibody (70R-3979)

TRAPPC1 antibody (70R-3979) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRAPPC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRAPPC1 antibody (70R-3979) | TRAPPC1 antibody (70R-3979) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors