TRAPPC2L antibody (70R-3900)

Rabbit polyclonal TRAPPC2L antibody raised against the N terminal of TRAPPC2L

Synonyms Polyclonal TRAPPC2L antibody, Anti-TRAPPC2L antibody, TRAPPC2L, TRAPPCL 2, Trafficking Protein Particle Complex 2-Like antibody, TRAPPCL-2, TRAPPCL 2 antibody, TRAPPCL-2 antibody, HSPC176 antibody, MGC111156 antibody
Specificity TRAPPC2L antibody was raised against the N terminal of TRAPPC2L
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TRAPPC2L antibody was raised using the N terminal of TRAPPC2L corresponding to a region with amino acids MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL
Assay Information TRAPPC2L Blocking Peptide, catalog no. 33R-5796, is also available for use as a blocking control in assays to test for specificity of this TRAPPC2L antibody


Western Blot analysis using TRAPPC2L antibody (70R-3900)

TRAPPC2L antibody (70R-3900) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRAPPC2L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRAPPC2L antibody (70R-3900) | TRAPPC2L antibody (70R-3900) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors