TRDMT1 antibody (70R-2240)

Rabbit polyclonal TRDMT1 antibody raised against the N terminal of TRDMT1

Synonyms Polyclonal TRDMT1 antibody, Anti-TRDMT1 antibody, TRDMT 1, M.HsaIIP antibody, PuMet antibody, DNMT2 antibody, RNMT1 antibody, tRNA Aspartic Acid Methyltransferase 1 antibody, TRDMT-1, TRDMT1, TRDMT-1 antibody, TRDMT 1 antibody
Specificity TRDMT1 antibody was raised against the N terminal of TRDMT1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TRDMT1 antibody was raised using the N terminal of TRDMT1 corresponding to a region with amino acids MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV
Assay Information TRDMT1 Blocking Peptide, catalog no. 33R-6114, is also available for use as a blocking control in assays to test for specificity of this TRDMT1 antibody


Western Blot analysis using TRDMT1 antibody (70R-2240)

TRDMT1 antibody (70R-2240) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRDMT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. TRDMT1 is a protein with similarity to DNA methyltransferases, but this protein does not display methyltransferase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRDMT1 antibody (70R-2240) | TRDMT1 antibody (70R-2240) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors