TRIB1 antibody (70R-3676)

Rabbit polyclonal TRIB1 antibody

Synonyms Polyclonal TRIB1 antibody, Anti-TRIB1 antibody, TRIB 1 antibody, GIG2 antibody, TRIB-1, Tribbles Homolog 1 antibody, TRIB 1, C8FW antibody, SKIP1 antibody, TRIB-1 antibody, TRIB1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TRIB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA
Assay Information TRIB1 Blocking Peptide, catalog no. 33R-9035, is also available for use as a blocking control in assays to test for specificity of this TRIB1 antibody


Western Blot analysis using TRIB1 antibody (70R-3676)

TRIB1 antibody (70R-3676) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRIB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRIB1 interacts with MAPK kinases and regulates activation of MAP kinases. TRIB1 may not display kinase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRIB1 antibody (70R-3676) | TRIB1 antibody (70R-3676) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors