TRIB2 antibody (70R-2069)

Rabbit polyclonal TRIB2 antibody

Synonyms Polyclonal TRIB2 antibody, Anti-TRIB2 antibody, TRIB 2 antibody, GS3955 antibody, TRIB-2, TRIB 2, Tribbles Homolog 2 antibody, TRIB2, TRB2 antibody, TRIB-2 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen TRIB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQE
Assay Information TRIB2 Blocking Peptide, catalog no. 33R-10196, is also available for use as a blocking control in assays to test for specificity of this TRIB2 antibody

Images

Western Blot analysis using TRIB2 antibody (70R-2069)

TRIB2 antibody (70R-2069) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRIB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRIB2 is one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRIB2 antibody (70R-2069) | TRIB2 antibody (70R-2069) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors