TRIM45 antibody (70R-2222)

Rabbit polyclonal TRIM45 antibody raised against the N terminal of TRIM45

Synonyms Polyclonal TRIM45 antibody, Anti-TRIM45 antibody, TRIM45, Tripartite Motif-Containing 45 antibody, FLJ13181 antibody, TRIM 45 antibody, TRIM-45, TRIM 45, RNF99 antibody, TRIM-45 antibody
Specificity TRIM45 antibody was raised against the N terminal of TRIM45
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TRIM45 antibody was raised using the N terminal of TRIM45 corresponding to a region with amino acids FKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRS
Assay Information TRIM45 Blocking Peptide, catalog no. 33R-2941, is also available for use as a blocking control in assays to test for specificity of this TRIM45 antibody


Western Blot analysis using TRIM45 antibody (70R-2222)

TRIM45 antibody (70R-2222) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRIM45 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRIM45 is a member of the tripartite motif family. It may function as a transcriptional repressor of the mitogen-activated protein kinase pathway. Alternatively spliced transcript variants have been described.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRIM45 antibody (70R-2222) | TRIM45 antibody (70R-2222) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors