TRIM54 antibody (70R-2647)

Rabbit polyclonal TRIM54 antibody raised against the N terminal of TRIM54

Synonyms Polyclonal TRIM54 antibody, Anti-TRIM54 antibody, RNF30 antibody, TRIM 54, TRIM-54, MURF-3 antibody, MURF antibody, TRIM-54 antibody, Tripartite Motif-Containing 54 antibody, TRIM 54 antibody, TRIM54
Specificity TRIM54 antibody was raised against the N terminal of TRIM54
Cross Reactivity Human
Applications WB
Immunogen TRIM54 antibody was raised using the N terminal of TRIM54 corresponding to a region with amino acids IYKQESSRPLHSKAEQHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHK
Assay Information TRIM54 Blocking Peptide, catalog no. 33R-4221, is also available for use as a blocking control in assays to test for specificity of this TRIM54 antibody

Images

Western Blot analysis using TRIM54 antibody (70R-2647)

TRIM54 antibody (70R-2647) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRIM54 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRIM54 contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRIM54 antibody (70R-2647) | TRIM54 antibody (70R-2647) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors