TRIM63 antibody (70R-2552)

Rabbit polyclonal TRIM63 antibody raised against the middle region of TRIM63

Synonyms Polyclonal TRIM63 antibody, Anti-TRIM63 antibody, MURF1 antibody, TRIM63, IRF antibody, TRIM 63 antibody, SMRZ antibody, MURF2 antibody, RNF28 antibody, FLJ32380 antibody, Tripartite Motif-Containing 63 antibody, TRIM-63, TRIM 63, TRIM-63 antibody
Specificity TRIM63 antibody was raised against the middle region of TRIM63
Cross Reactivity Human
Applications WB
Immunogen TRIM63 antibody was raised using the middle region of TRIM63 corresponding to a region with amino acids EQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ
Assay Information TRIM63 Blocking Peptide, catalog no. 33R-2669, is also available for use as a blocking control in assays to test for specificity of this TRIM63 antibody

Western Blot analysis using TRIM63 antibody (70R-2552)

TRIM63 antibody (70R-2552) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRIM63 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the RING zinc finger protein family found in striated muscle and iris. The product of this gene is localized to the Z-line and M-line lattices of myofibrils, where titin's N-terminal and C-terminal regions respectively bind to the sarcomere. In vitro binding studies have shown that this protein also binds directly to titin near the region of titin containing kinase activity. Another member of this protein family binds to microtubules. Since these family members can form heterodimers, this suggests that these proteins may serve as a link between titin kinase and microtubule-dependent signal pathways in muscle.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using TRIM63 antibody (70R-2552) | TRIM63 antibody (70R-2552) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors