TRIML1 antibody (70R-2273)

Rabbit polyclonal TRIML1 antibody raised against the middle region of TRIML1

Synonyms Polyclonal TRIML1 antibody, Anti-TRIML1 antibody, TRIML 1 antibody, MGC138639 antibody, Tripartite Motif Family-Like 1 antibody, TRIML1, TRIML-1 antibody, TRIML 1, MGC138638 antibody, TRIML-1, FLJ36180 antibody, RNF209 antibody
Specificity TRIML1 antibody was raised against the middle region of TRIML1
Cross Reactivity Human
Applications WB
Immunogen TRIML1 antibody was raised using the middle region of TRIML1 corresponding to a region with amino acids DSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGV
Assay Information TRIML1 Blocking Peptide, catalog no. 33R-2184, is also available for use as a blocking control in assays to test for specificity of this TRIML1 antibody


Western Blot analysis using TRIML1 antibody (70R-2273)

TRIML1 antibody (70R-2273) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRIML1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRIML1 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of the TRIML1 protein remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRIML1 antibody (70R-2273) | TRIML1 antibody (70R-2273) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors