TRIML2 antibody (70R-4258)

Rabbit polyclonal TRIML2 antibody raised against the middle region of TRIML2

Synonyms Polyclonal TRIML2 antibody, Anti-TRIML2 antibody, spryd6 antibody, TRIML-2, FLJ25801 antibody, TRIML2, TRIML-2 antibody, MGC138166 antibody, TRIML 2, Tripartite Motif Family-Like 2 antibody, TRIML 2 antibody, MGC138164 antibody
Specificity TRIML2 antibody was raised against the middle region of TRIML2
Cross Reactivity Human
Applications WB
Immunogen TRIML2 antibody was raised using the middle region of TRIML2 corresponding to a region with amino acids TEMSLIYNFSHCAFQGALRPVFSLCIPNGDTSPDSLTILQHGPSCDATVS
Assay Information TRIML2 Blocking Peptide, catalog no. 33R-9049, is also available for use as a blocking control in assays to test for specificity of this TRIML2 antibody

Images

Western Blot analysis using TRIML2 antibody (70R-4258)

TRIML2 antibody (70R-4258) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRIML2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of TRIML2 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRIML2 antibody (70R-4258) | TRIML2 antibody (70R-4258) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors