TRMT11 antibody (70R-2110)

Rabbit polyclonal TRMT11 antibody

Synonyms Polyclonal TRMT11 antibody, Anti-TRMT11 antibody, tRNA Methyltransferase 11 Homolog antibody, MDS024 antibody, TRMT-11, C6orf75 antibody, TRMT-11 antibody, dJ187J11 antibody, TRM11 antibody, TRMT 11, dJ187J11.2 antibody, TRMT 11 antibody, TRMT11
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TRMT11 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP
Assay Information TRMT11 Blocking Peptide, catalog no. 33R-4021, is also available for use as a blocking control in assays to test for specificity of this TRMT11 antibody

Images

Western Blot analysis using TRMT11 antibody (70R-2110)

TRMT11 antibody (70R-2110) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRMT11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRMT11 belongs to the methyltransferase superfamily. It is a catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRMT11 antibody (70R-2110) | TRMT11 antibody (70R-2110) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors