TRNT1 antibody (70R-1345)

Rabbit polyclonal TRNT1 antibody raised against the N terminal of TRNT1

Synonyms Polyclonal TRNT1 antibody, Anti-TRNT1 antibody, TRNT 1, TRNT-1, TRNT1, TRNT-1 antibody, tRNA Nucleotidyl Transferase Cca-Adding 1 antibody, TRNT 1 antibody
Specificity TRNT1 antibody was raised against the N terminal of TRNT1
Cross Reactivity Human
Applications IHC, WB
Immunogen TRNT1 antibody was raised using the N terminal of TRNT1 corresponding to a region with amino acids PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT
Assay Information TRNT1 Blocking Peptide, catalog no. 33R-7294, is also available for use as a blocking control in assays to test for specificity of this TRNT1 antibody


Immunohistochemical staining using TRNT1 antibody (70R-1345)

TRNT1 antibody was used for immunohistochemistry at a concentration of 16.0 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TRNT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 16 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRNT1 belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. It adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using TRNT1 antibody (70R-1345) | TRNT1 antibody was used for immunohistochemistry at a concentration of 16.0 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using TRNT1 antibody (70R-1345) | TRNT1 antibody (70R-1345) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors