Troponin I Type 3 antibody (70R-4597)

Rabbit polyclonal Troponin I Type 3 antibody

Synonyms Polyclonal Troponin I Type 3 antibody, Anti-Troponin I Type 3 antibody, TNNI3 antibody, MGC116817 antibody, CMH7 antibody, cTnI antibody, TNNC1 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen Troponin I Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNI
Assay Information Troponin I Type 3 Blocking Peptide, catalog no. 33R-8257, is also available for use as a blocking control in assays to test for specificity of this Troponin I Type 3 antibody

Images

Immunohistochemical staining using Troponin I Type 3 antibody (70R-4597)

Heart

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TNNI3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit; blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. TNNI3 is the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using Troponin I Type 3 antibody (70R-4597) | Heart

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors