TROVE2 antibody (70R-4760)

Rabbit polyclonal TROVE2 antibody raised against the N terminal of TROVE2

Synonyms Polyclonal TROVE2 antibody, Anti-TROVE2 antibody, Trove Domain Family Member 2 antibody, TROVE2, TROVE-2 antibody, TROVE-2, TROVE 2 antibody, TROVE 2
Specificity TROVE2 antibody was raised against the N terminal of TROVE2
Cross Reactivity Human,Mouse,Dog
Applications IHC, WB
Immunogen TROVE2 antibody was raised using the N terminal of TROVE2 corresponding to a region with amino acids QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR
Assay Information TROVE2 Blocking Peptide, catalog no. 33R-7498, is also available for use as a blocking control in assays to test for specificity of this TROVE2 antibody

Images

Immunohistochemical staining using TROVE2 antibody (70R-4760)

TROVE2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of fundic gland (arrows) in Human Stomach. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TROVE2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TROVE2 belongs to the Ro 60 kDa family. It is RNA-binding protein that binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using TROVE2 antibody (70R-4760) | TROVE2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of fundic gland (arrows) in Human Stomach. Magnification is at 400X
  • Western Blot analysis using TROVE2 antibody (70R-4760) | TROVE2 antibody (70R-4760) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors