TRPC3 antibody (70R-5179)

Rabbit polyclonal TRPC3 antibody raised against the n terminal of TRPC3

Synonyms Polyclonal TRPC3 antibody, Anti-TRPC3 antibody, TRPC 3, TRP3 antibody, TRPC-3 antibody, TRPC 3 antibody, TRPC3, Transient Receptor Potential Cation Channel Subfamily C Member 3 antibody, TRPC-3
Specificity TRPC3 antibody was raised against the n terminal of TRPC3
Cross Reactivity Human
Applications WB
Immunogen TRPC3 antibody was raised using the N terminal of TRPC3 corresponding to a region with amino acids MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYG
Assay Information TRPC3 Blocking Peptide, catalog no. 33R-5923, is also available for use as a blocking control in assays to test for specificity of this TRPC3 antibody


Western Blot analysis using TRPC3 antibody (70R-5179)

TRPC3 antibody (70R-5179) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRPC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRPC3 is thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. TRPC3 is activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C, and by inositol-1,4,5-triphosphate receptors (ITPR) with bound IP3. TRPC3 may also be activated by internal calcium store depletion.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRPC3 antibody (70R-5179) | TRPC3 antibody (70R-5179) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors