TRPC4 antibody (70R-5142)

Rabbit polyclonal TRPC4 antibody raised against the middle region of TRPC4

Synonyms Polyclonal TRPC4 antibody, Anti-TRPC4 antibody, MGC119572 antibody, TRPC-4, Transient Receptor Potential Cation Channel Subfamily C Member 4 antibody, MGC119570 antibody, TRPC-4 antibody, TRPC 4 antibody, MGC119573 antibody, TRPC 4, TRP4 antibody, HTRP4 antibody, MGC119571 antibody, TRPC4
Specificity TRPC4 antibody was raised against the middle region of TRPC4
Cross Reactivity Human
Applications WB
Immunogen TRPC4 antibody was raised using the middle region of TRPC4 corresponding to a region with amino acids CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL
Assay Information TRPC4 Blocking Peptide, catalog no. 33R-1763, is also available for use as a blocking control in assays to test for specificity of this TRPC4 antibody

Images

Western Blot analysis using TRPC4 antibody (70R-5142)

TRPC4 antibody (70R-5142) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 112 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRPC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRPC4 is thought to form a receptor-activated non-selective calcium permeant cation channel. TRPC4 probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. It has also been shown to be calcium-selective. TRPC4 may also be activated by intracellular calcium store depletion.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRPC4 antibody (70R-5142) | TRPC4 antibody (70R-5142) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors