TRPM4 antibody (70R-5157)

Rabbit polyclonal TRPM4 antibody raised against the N terminal of TRPM4

Synonyms Polyclonal TRPM4 antibody, Anti-TRPM4 antibody, TRPM-4, FLJ20041 antibody, TRPM-4 antibody, Transient Receptor Potential Cation Channel Subfamily M Member 4 antibody, TRPM4B antibody, TRPM4, TRPM 4, TRPM 4 antibody
Specificity TRPM4 antibody was raised against the N terminal of TRPM4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TRPM4 antibody was raised using the N terminal of TRPM4 corresponding to a region with amino acids ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI
Assay Information TRPM4 Blocking Peptide, catalog no. 33R-2560, is also available for use as a blocking control in assays to test for specificity of this TRPM4 antibody

Images

Western Blot analysis using TRPM4 antibody (70R-5157)

TRPM4 antibody (70R-5157) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 134 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRPM4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRPM4 is a calcium-activated non selective (CAN) cation channel that mediates membrane depolarization. While it is activated by increase in intracellular Ca2+, it is impermeable to it. TRPM4 mediates transport of monovalent cations (Na+ > K+ > Cs+ > Li+), leading to depolarize the membrane. It thereby plays a central role in cadiomyocytes, neurons from entorhinal cortex, dorsal root and vomeronasal neurons, endocrine pancreas cells, kidney epithelial cells, cochlea hair cells etc. Participates in T-cell activation by modulating Ca2+ oscillations after T lymphocyte activation, which is required for NFAT-dependent IL2 production.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRPM4 antibody (70R-5157) | TRPM4 antibody (70R-5157) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors