TRPM5 antibody (70R-5146)

Rabbit polyclonal TRPM5 antibody raised against the N terminal of TRPM5

Synonyms Polyclonal TRPM5 antibody, Anti-TRPM5 antibody, TRPM 5, TRPM-5 antibody, TRPM 5 antibody, Transient Receptor Potential Cation Channel Subfamily M Member 5 antibody, LTRPC5 antibody, MTR1 antibody, TRPM-5, TRPM5
Specificity TRPM5 antibody was raised against the N terminal of TRPM5
Cross Reactivity Human,Mouse
Applications WB
Immunogen TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV
Assay Information TRPM5 Blocking Peptide, catalog no. 33R-2505, is also available for use as a blocking control in assays to test for specificity of this TRPM5 antibody


Western Blot analysis using TRPM5 antibody (70R-5146)

TRPM5 antibody (70R-5146) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 131 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRPM5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRPM5 is a voltage-modulated Ca(2+)-activated, monovalent cation channel (VCAM) that mediates a transient membrane depolarization and plays a central role in taste transduction. It is activated by arachidonic acid in vitro. It may be involved in perception of bitter, sweet and umami tastes. It may also be involved in sensing semiochemicals.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRPM5 antibody (70R-5146) | TRPM5 antibody (70R-5146) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £272.51
Size: 50 ug
View Our Distributors