TRPV5 antibody (70R-5176)

Rabbit polyclonal TRPV5 antibody raised against the N terminal of TRPV5

Synonyms Polyclonal TRPV5 antibody, Anti-TRPV5 antibody, TRPV 5 antibody, TRPV-5, Transient Receptor Potential Cation Channel Subfamily V Member 5 antibody, CAT2 antibody, TRPV5, ECAC1 antibody, OTRPC3 antibody, TRPV-5 antibody, TRPV 5
Specificity TRPV5 antibody was raised against the N terminal of TRPV5
Cross Reactivity Human
Applications WB
Immunogen TRPV5 antibody was raised using the N terminal of TRPV5 corresponding to a region with amino acids MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
Assay Information TRPV5 Blocking Peptide, catalog no. 33R-6206, is also available for use as a blocking control in assays to test for specificity of this TRPV5 antibody


Western Blot analysis using TRPV5 antibody (70R-5176)

TRPV5 antibody (70R-5176) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRPV5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRPV5 is a member of the transient receptor family and the TrpV subfamily. TRPV5, a calcium-selective channel, has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. TRPV5 forms homotetramers or heterotetramers and is activated by a low internal calcium level.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRPV5 antibody (70R-5176) | TRPV5 antibody (70R-5176) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors