TSPYL6 antibody (70R-1994)

Rabbit polyclonal TSPYL6 antibody raised against the N terminal of TSPYL6

Synonyms Polyclonal TSPYL6 antibody, Anti-TSPYL6 antibody, TSPYL 6, TSPYL-6, TSPYL-6 antibody, Testis-Specific Y-encoded-like protein 6 antibody, Tspy-Like 6 antibody, DKFZp434B125 antibody, TSPYL 6 antibody, TSPYL6
Specificity TSPYL6 antibody was raised against the N terminal of TSPYL6
Cross Reactivity Human
Applications WB
Immunogen TSPYL6 antibody was raised using the N terminal of TSPYL6 corresponding to a region with amino acids MSLPESPHSPATLDYALEDPHQGQRSREKSKATEVMADMFDGRLEPIVFP
Assay Information TSPYL6 Blocking Peptide, catalog no. 33R-6465, is also available for use as a blocking control in assays to test for specificity of this TSPYL6 antibody


Western Blot analysis using TSPYL6 antibody (70R-1994)

TSPYL6 antibody (70R-1994) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSPYL6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TSPYL6 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TSPYL6 antibody (70R-1994) | TSPYL6 antibody (70R-1994) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors