TTC5 antibody (70R-2121)

Rabbit polyclonal TTC5 antibody raised against the C terminal of TTC5

Synonyms Polyclonal TTC5 antibody, Anti-TTC5 antibody, TTC-5 antibody, TTC 5, TTC-5, Strap antibody, TTC 5 antibody, Tetratricopeptide Repeat Domain 5 antibody, TTC5
Specificity TTC5 antibody was raised against the C terminal of TTC5
Cross Reactivity Human
Applications WB
Immunogen TTC5 antibody was raised using the C terminal of TTC5 corresponding to a region with amino acids GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV
Assay Information TTC5 Blocking Peptide, catalog no. 33R-3213, is also available for use as a blocking control in assays to test for specificity of this TTC5 antibody


Western Blot analysis using TTC5 antibody (70R-2121)

TTC5 antibody (70R-2121) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TTC5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TTC5 is an adapter protein involved in p53/TP53 response that acts by regulating and mediating the assembly of multi-protein complexes. It is required to facilitate the interaction between JMY and p300/EP300 and increase p53/TP53-dependent transcription and apoptosis. It prevents p53/TP53 degradation by MDM2.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TTC5 antibody (70R-2121) | TTC5 antibody (70R-2121) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors