TTL antibody (70R-2530)

Rabbit polyclonal TTL antibody raised against the middle region of TTL

Synonyms Polyclonal TTL antibody, Anti-TTL antibody, MGC46235 antibody, Tubulin Tyrosine Ligase antibody
Specificity TTL antibody was raised against the middle region of TTL
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TTL antibody was raised using the middle region of TTL corresponding to a region with amino acids LYREGVLRTASEPYHVDNFQDKTCHLTNHCIQKEYSKNYGKYEEGNEMFF
Assay Information TTL Blocking Peptide, catalog no. 33R-5571, is also available for use as a blocking control in assays to test for specificity of this TTL antibody

Images

Western Blot analysis using TTL antibody (70R-2530)

TTL antibody (70R-2530) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TTL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TTL catalyzes the post-translational addition of a tyrosine to the C-terminal end of detyrosinated alpha-tubulin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TTL antibody (70R-2530) | TTL antibody (70R-2530) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors