TUFM antibody (70R-2544)

Rabbit polyclonal TUFM antibody raised against the middle region of TUFM

Synonyms Polyclonal TUFM antibody, Anti-TUFM antibody, COXPD4 antibody, Tu Translation Elongation Factor Mitochondrial antibody, EF-TuMT antibody, EFTU antibody
Specificity TUFM antibody was raised against the middle region of TUFM
Cross Reactivity Human
Applications WB
Immunogen TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM
Assay Information TUFM Blocking Peptide, catalog no. 33R-7046, is also available for use as a blocking control in assays to test for specificity of this TUFM antibody


Western Blot analysis using TUFM antibody (70R-2544)

TUFM antibody (70R-2544) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TUFM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TUFM is a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TUFM antibody (70R-2544) | TUFM antibody (70R-2544) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors