TXNDC5 antibody (70R-2551)

Rabbit polyclonal TXNDC5 antibody raised against the N terminal of TXNDC5

Synonyms Polyclonal TXNDC5 antibody, Anti-TXNDC5 antibody, TXNDC5, TXNDC 5, Thioredoxin Domain Containing 5 antibody, TXNDC 5 antibody, ERP46 antibody, EndoPDI antibody, UNQ364 antibody, MGC3178 antibody, TXNDC-5, TXNDC-5 antibody
Specificity TXNDC5 antibody was raised against the N terminal of TXNDC5
Cross Reactivity Human
Applications WB
Immunogen TXNDC5 antibody was raised using the N terminal of TXNDC5 corresponding to a region with amino acids ARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADMFTHGIQSAAHFVMFF
Assay Information TXNDC5 Blocking Peptide, catalog no. 33R-1460, is also available for use as a blocking control in assays to test for specificity of this TXNDC5 antibody

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TXNDC5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TXNDC5 is a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors