TYRP1 antibody (70R-1859)

Rabbit polyclonal TYRP1 antibody raised against the N terminal of TYRP1

Synonyms Polyclonal TYRP1 antibody, Anti-TYRP1 antibody, b-PROTEIN antibody, TYRP-1 antibody, CAS2 antibody, TYRP 1, TYRP1, TRP antibody, TYRP 1 antibody, TYRP-1, GP75 antibody, CATB antibody, Tyrosinase-Related Protein 1 antibody, TYRP antibody
Specificity TYRP1 antibody was raised against the N terminal of TYRP1
Cross Reactivity Human,Mouse,Dog
Applications WB
Immunogen TYRP1 antibody was raised using the N terminal of TYRP1 corresponding to a region with amino acids AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF
Assay Information TYRP1 Blocking Peptide, catalog no. 33R-1310, is also available for use as a blocking control in assays to test for specificity of this TYRP1 antibody


Western Blot analysis using TYRP1 antibody (70R-1859)

TYRP1 antibody (70R-1859) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TYRP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TYRP1 catalyses the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. It may regulate or influence the type of melanin synthesized.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TYRP1 antibody (70R-1859) | TYRP1 antibody (70R-1859) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors