U1SNRNPBP antibody (70R-1436)

Rabbit polyclonal U1SNRNPBP antibody raised against the N terminal of U1SNRNPBP

Synonyms Polyclonal U1SNRNPBP antibody, Anti-U1SNRNPBP antibody, USNRNPBP-1, USNRNPBP 1, USNRNPBP 1 antibody, USNRNPBP-1 antibody, U1SNRNPBP, U11/U12 Snrnp 35K antibody
Specificity U1SNRNPBP antibody was raised against the N terminal of U1SNRNPBP
Cross Reactivity Human
Applications IHC, WB
Immunogen U1SNRNPBP antibody was raised using the N terminal of U1SNRNPBP corresponding to a region with amino acids RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR
Assay Information U1SNRNPBP Blocking Peptide, catalog no. 33R-7830, is also available for use as a blocking control in assays to test for specificity of this U1SNRNPBP antibody


Immunohistochemical staining using U1SNRNPBP antibody (70R-1436)

U1SNRNPBP antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of U1SNRNPBP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance U1SNRNPBP is a homolog of U1-snRNP binding protein. Its N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, a characteristic of a variety of splicing factors.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using U1SNRNPBP antibody (70R-1436) | U1SNRNPBP antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using U1SNRNPBP antibody (70R-1436) | U1SNRNPBP antibody (70R-1436) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors