UBE2C antibody (70R-5588)

Rabbit polyclonal UBE2C antibody raised against the middle region of UBE2C

Synonyms Polyclonal UBE2C antibody, Anti-UBE2C antibody, UBEC-2, UBCH10 antibody, UBEC 2, Ubiquitin-Conjugating Enzyme E2C antibody, UBEC-2 antibody, dJ447F3.2 antibody, UBE2C, UBEC 2 antibody
Specificity UBE2C antibody was raised against the middle region of UBE2C
Cross Reactivity Human,Mouse
Applications WB
Immunogen UBE2C antibody was raised using the middle region of UBE2C corresponding to a region with amino acids QGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNP
Assay Information UBE2C Blocking Peptide, catalog no. 33R-7567, is also available for use as a blocking control in assays to test for specificity of this UBE2C antibody


Western Blot analysis using UBE2C antibody (70R-5588)

UBE2C antibody (70R-5588) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBE2C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2C is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using UBE2C antibody (70R-5588) | UBE2C antibody (70R-5588) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors