UBE2J2 antibody (70R-1777)

Rabbit polyclonal UBE2J2 antibody

Synonyms Polyclonal UBE2J2 antibody, Anti-UBE2J2 antibody, UBE2J2, Ubiquitin-Conjugating Enzyme E2 J2 antibody, Ubc6 Homolog Yeast antibody, UBEJ 2, NCUBE2 antibody, UBEJ-2 antibody, UBEJ 2 antibody, PRO2121 antibody, UBEJ-2
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen UBE2J2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK
Assay Information UBE2J2 Blocking Peptide, catalog no. 33R-3342, is also available for use as a blocking control in assays to test for specificity of this UBE2J2 antibody

Images

Immunohistochemical staining using UBE2J2 antibody (70R-1777)

UBE2J2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of UBE2J2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2J2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using UBE2J2 antibody (70R-1777) | UBE2J2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows)  in Human Intestine. Magnification is at 400X
  • Western Blot analysis using UBE2J2 antibody (70R-1777) | UBE2J2 antibody (70R-1777) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors