UBE2L3 antibody (70R-1044)

Rabbit polyclonal UBE2L3 antibody raised against the C terminal of UBE2L3

Synonyms Polyclonal UBE2L3 antibody, Anti-UBE2L3 antibody, UBEL3-2 antibody, E2-F1 antibody, Ubiquitin-Conjugating Enzyme E2L 3 antibody, UbcM4 antibody, UBEL3 2 antibody, L-UBC antibody, UBE2L3, UBEL3 2, UBEL3-2, UBCH7 antibody
Specificity UBE2L3 antibody was raised against the C terminal of UBE2L3
Cross Reactivity Human
Applications IHC, WB
Immunogen UBE2L3 antibody was raised using the C terminal of UBE2L3 corresponding to a region with amino acids TDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEK
Assay Information UBE2L3 Blocking Peptide, catalog no. 33R-9017, is also available for use as a blocking control in assays to test for specificity of this UBE2L3 antibody

Images

Western Blot analysis using UBE2L3 antibody (70R-1044)

UBE2L3 antibody (70R-1044) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 75 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of UBE2L3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). UBE2L3 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UBE2L3 antibody (70R-1044) | UBE2L3 antibody (70R-1044) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors