UBE3B antibody (70R-2574)

Rabbit polyclonal UBE3B antibody raised against the middle region of UBE3B

Synonyms Polyclonal UBE3B antibody, Anti-UBE3B antibody, UBEB-3 antibody, DKFZp686A1051 antibody, Ubiquitin Protein Ligase E3B antibody, UBEB 3 antibody, FLJ45294 antibody, UBEB 3, DKFZp586K2123 antibody, MGC131858 antibody, UBE3B, UBEB-3, MGC78388 antibody
Specificity UBE3B antibody was raised against the middle region of UBE3B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen UBE3B antibody was raised using the middle region of UBE3B corresponding to a region with amino acids VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE
Assay Information UBE3B Blocking Peptide, catalog no. 33R-9458, is also available for use as a blocking control in assays to test for specificity of this UBE3B antibody


Western Blot analysis using UBE3B antibody (70R-2574)

UBE3B antibody (70R-2574) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 123 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBE3B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE3B is a member of the E3 ubiquitin-conjugating enzyme family. UBE3B may interact with other proteins and play a role in stress response.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using UBE3B antibody (70R-2574) | UBE3B antibody (70R-2574) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors