Ubiquilin 1 antibody (70R-3478)

Rabbit polyclonal Ubiquilin 1 antibody raised against the middle region of UBQLN1

Synonyms Polyclonal Ubiquilin 1 antibody, Anti-Ubiquilin 1 antibody, Ubiquilin 1 antibody, PLIC-1 antibody, XDRP1 antibody, DSK2 antibody, Ubiquilin -1 antibody, FLJ90054 antibody, UBQLN1 antibody, Ubiquilin 1, Ubiquilin 1, Ubiquilin -1, DA41 antibody
Specificity Ubiquilin 1 antibody was raised against the middle region of UBQLN1
Cross Reactivity Human
Applications WB
Immunogen Ubiquilin 1 antibody was raised using the middle region of UBQLN1 corresponding to a region with amino acids QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA
Assay Information Ubiquilin 1 Blocking Peptide, catalog no. 33R-7544, is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 1 antibody


Immunohistochemical staining using Ubiquilin 1 antibody (70R-3478)

Ubiquilin 1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBQLN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UBQLN1 is an ubiquitin-like protein (ubiquilin) that shares a high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain an N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using Ubiquilin 1 antibody (70R-3478) | Ubiquilin 1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using Ubiquilin 1 antibody (70R-3478) | Ubiquilin 1 antibody (70R-3478) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors