Ubiquilin 3 antibody (70R-2645)

Rabbit polyclonal Ubiquilin 3 antibody raised against the N terminal of UBQLN3

Synonyms Polyclonal Ubiquilin 3 antibody, Anti-Ubiquilin 3 antibody, Ubiquilin 3 antibody, Ubiquilin -3, Ubiquilin 3, TUP-1 antibody, UBQLN3 antibody, Ubiquilin -3 antibody, Ubiquilin 3
Specificity Ubiquilin 3 antibody was raised against the N terminal of UBQLN3
Cross Reactivity Human,Mouse
Applications WB
Immunogen Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE
Assay Information Ubiquilin 3 Blocking Peptide, catalog no. 33R-5210, is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 3 antibody

Images

Western Blot analysis using Ubiquilin 3 antibody (70R-2645)

Ubiquilin 3 antibody (70R-2645) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBQLN3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UBQLN3 is an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Ubiquilin 3 antibody (70R-2645) | Ubiquilin 3 antibody (70R-2645) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors