UCHL5IP antibody (70R-3801)

Rabbit polyclonal UCHL5IP antibody raised against the middle region of UCHL5IP

Synonyms Polyclonal UCHL5IP antibody, Anti-UCHL5IP antibody, UCHLIP-5 antibody, UIP1 antibody, UCHL5IP, UCHLIP 5, HSXQ28ORF antibody, Uchl5 Interacting Protein antibody, UCHLIP 5 antibody, UCHLIP-5
Specificity UCHL5IP antibody was raised against the middle region of UCHL5IP
Cross Reactivity Human
Applications WB
Immunogen UCHL5IP antibody was raised using the middle region of UCHL5IP corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC
Assay Information UCHL5IP Blocking Peptide, catalog no. 33R-5125, is also available for use as a blocking control in assays to test for specificity of this UCHL5IP antibody

Images

Western Blot analysis using UCHL5IP antibody (70R-3801)

UCHL5IP antibody (70R-3801) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UCHL5IP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UCHL5IP antibody (70R-3801) | UCHL5IP antibody (70R-3801) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors