UEVLD antibody (70R-3803)

Rabbit polyclonal UEVLD antibody raised against the middle region of UEVLD

Synonyms Polyclonal UEVLD antibody, Anti-UEVLD antibody, UEV3 antibody, ATTP antibody, Uev And Lactate/Malate Dehyrogenase Domains antibody, FLJ11068 antibody
Specificity UEVLD antibody was raised against the middle region of UEVLD
Cross Reactivity Human
Applications WB
Immunogen UEVLD antibody was raised using the middle region of UEVLD corresponding to a region with amino acids SLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGE
Assay Information UEVLD Blocking Peptide, catalog no. 33R-8627, is also available for use as a blocking control in assays to test for specificity of this UEVLD antibody

Images

Western Blot analysis using UEVLD antibody (70R-3803)

UEVLD antibody (70R-3803) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UEVLD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UEVLD is a possible negative regulator of polyubiquitination.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UEVLD antibody (70R-3803) | UEVLD antibody (70R-3803) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors