UGCGL1 antibody (70R-4490)

Rabbit polyclonal UGCGL1 antibody raised against the middle region of UGCGL1

Synonyms Polyclonal UGCGL1 antibody, Anti-UGCGL1 antibody, UGCGL 1 antibody, UGCGL1, FLJ23671 antibody, UGCGL 1, Udp-Glucose Glycoprotein Glucosyltransferase 1 antibody, UGCGL-1 antibody, FLJ23796 antibody, HUGT1 antibody, UGCGL-1
Specificity UGCGL1 antibody was raised against the middle region of UGCGL1
Cross Reactivity Human
Applications WB
Immunogen UGCGL1 antibody was raised using the middle region of UGCGL1 corresponding to a region with amino acids AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE
Assay Information UGCGL1 Blocking Peptide, catalog no. 33R-1061, is also available for use as a blocking control in assays to test for specificity of this UGCGL1 antibody

Images

Western Blot analysis using UGCGL1 antibody (70R-4490)

UGCGL1 antibody (70R-4490) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 175 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UGCGL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UGCGL1 antibody (70R-4490) | UGCGL1 antibody (70R-4490) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors