UGT3A2 antibody (70R-1871)

Rabbit polyclonal UGT3A2 antibody raised against the N terminal of UGT3A2

Synonyms Polyclonal UGT3A2 antibody, Anti-UGT3A2 antibody, UGT3A2, MGC119429 antibody, Udp Glycosyltransferase 3 Family Polypeptide A2 antibody, MGC119426 antibody, UGTA2-3, UGTA2 3, UGTA2-3 antibody, UGTA2 3 antibody
Specificity UGT3A2 antibody was raised against the N terminal of UGT3A2
Cross Reactivity Human
Applications WB
Immunogen UGT3A2 antibody was raised using the N terminal of UGT3A2 corresponding to a region with amino acids HNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEET
Assay Information UGT3A2 Blocking Peptide, catalog no. 33R-3804, is also available for use as a blocking control in assays to test for specificity of this UGT3A2 antibody


Western Blot analysis using UGT3A2 antibody (70R-1871)

UGT3A2 antibody (70R-1871) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of UGT3A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using UGT3A2 antibody (70R-1871) | UGT3A2 antibody (70R-1871) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors