UMPS antibody (70R-2670)

Rabbit polyclonal UMPS antibody raised against the C terminal of UMPS

Synonyms Polyclonal UMPS antibody, Anti-UMPS antibody, Uridine Monophosphate Synthetase antibody, OPRT antibody
Specificity UMPS antibody was raised against the C terminal of UMPS
Cross Reactivity Human,Mouse
Applications WB
Immunogen UMPS antibody was raised using the C terminal of UMPS corresponding to a region with amino acids VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII
Assay Information UMPS Blocking Peptide, catalog no. 33R-9552, is also available for use as a blocking control in assays to test for specificity of this UMPS antibody


Western Blot analysis using UMPS antibody (70R-2670)

UMPS antibody (70R-2670) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UMPS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance OPRT (UMPS) is involved in early events of pancreatic and gallbladder carcinogenesis and invasion of hepatocellular carcinomas. Orotate phosphoribosyltransferase is involved in the invasion and metastasis of colorectal carcinoma. Determination of OPRT levels in gastric carcinoma tissue enables to predict the response to S-1-based neoadjuvant/adjuvant chemotherapy.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using UMPS antibody (70R-2670) | UMPS antibody (70R-2670) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors