UNQ1887 antibody (70R-4578)

Rabbit polyclonal UNQ1887 antibody raised against the middle region of UNQ1887

Synonyms Polyclonal UNQ1887 antibody, Anti-UNQ1887 antibody, DKFZp586C1324 antibody, MGC126676 antibody, Signal Peptide Peptidase 3 antibody, IMP2 antibody, UNQ 1887 antibody, PSL4 antibody, SPPL3 antibody, PRO4332 antibody, UNQ-1887, UNQ-1887 antibody, MGC90402 antibody, MGC126674 antibody, UNQ1887, MDHV1887 antibody, UNQ 1887
Specificity UNQ1887 antibody was raised against the middle region of UNQ1887
Cross Reactivity Human
Applications WB
Immunogen UNQ1887 antibody was raised using the middle region of UNQ1887 corresponding to a region with amino acids VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHF
Assay Information UNQ1887 Blocking Peptide, catalog no. 33R-9700, is also available for use as a blocking control in assays to test for specificity of this UNQ1887 antibody


Western Blot analysis using UNQ1887 antibody (70R-4578)

UNQ1887 antibody (70R-4578) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UNQ1887 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UNQ1887 may act as intramembrane protease.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using UNQ1887 antibody (70R-4578) | UNQ1887 antibody (70R-4578) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors