UPB1 antibody (70R-2279)

Rabbit polyclonal UPB1 antibody raised against the middle region of UPB1

Synonyms Polyclonal UPB1 antibody, Anti-UPB1 antibody, UPB 1, UPB 1 antibody, UPB-1, UPB-1 antibody, BUP1 antibody, UPB1, Ureidopropionase Beta antibody
Specificity UPB1 antibody was raised against the middle region of UPB1
Cross Reactivity Human
Applications WB
Immunogen UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids NRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDG
Assay Information UPB1 Blocking Peptide, catalog no. 33R-6866, is also available for use as a blocking control in assays to test for specificity of this UPB1 antibody

Images

Western Blot analysis using UPB1 antibody (70R-2279)

UPB1 antibody (70R-2279) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UPB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UPB1 is a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UPB1 antibody (70R-2279) | UPB1 antibody (70R-2279) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors