UPF3A antibody (70R-4731)

Rabbit polyclonal UPF3A antibody

Synonyms Polyclonal UPF3A antibody, Anti-UPF3A antibody, RENT3A antibody, UPFA-3, UPFA-3 antibody, UPFA 3, UPF3 antibody, UPFA 3 antibody, HUPF3A antibody, Upf3 Regulator Of Nonsense Transcripts Homolog A antibody, UPF3A
Cross Reactivity Human
Applications WB
Immunogen UPF3A antibody was raised using a synthetic peptide corresponding to a region with amino acids QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG
Assay Information UPF3A Blocking Peptide, catalog no. 33R-7719, is also available for use as a blocking control in assays to test for specificity of this UPF3A antibody


Western Blot analysis using UPF3A antibody (70R-4731)

UPF3A antibody (70R-4731) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UPF3A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UPF3A is part of a multiprotein post-splicing mRNP complex involved in both mRNA nuclear export and mRNA surveillance. UPF3A is involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using UPF3A antibody (70R-4731) | UPF3A antibody (70R-4731) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors