USP18 antibody (70R-4407)

Rabbit polyclonal USP18 antibody raised against the N terminal of USP18

Synonyms Polyclonal USP18 antibody, Anti-USP18 antibody, USP 18, ISG43 antibody, USP-18 antibody, USP18, UBP43 antibody, Ubiquitin Specific Peptidase 18 antibody, USP-18, USP 18 antibody
Specificity USP18 antibody was raised against the N terminal of USP18
Cross Reactivity Human
Applications WB
Immunogen USP18 antibody was raised using the N terminal of USP18 corresponding to a region with amino acids MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH
Assay Information USP18 Blocking Peptide, catalog no. 33R-6322, is also available for use as a blocking control in assays to test for specificity of this USP18 antibody


Western Blot analysis using USP18 antibody (70R-4407)

USP18 antibody (70R-4407) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of USP18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance USP18, a member of the deubiquitinating protease family of enzymes, removes ubiquitin adducts from a broad range of protein substrates.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using USP18 antibody (70R-4407) | USP18 antibody (70R-4407) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors