USP36 antibody (70R-3767)

Rabbit polyclonal USP36 antibody raised against the N terminal of USP36

Synonyms Polyclonal USP36 antibody, Anti-USP36 antibody, USP36, Ubiquitin Specific Peptidase 36 antibody, DUB1 antibody, USP-36 antibody, USP-36, USP 36, USP 36 antibody
Specificity USP36 antibody was raised against the N terminal of USP36
Cross Reactivity Human
Applications WB
Immunogen USP36 antibody was raised using the N terminal of USP36 corresponding to a region with amino acids SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV
Assay Information USP36 Blocking Peptide, catalog no. 33R-8754, is also available for use as a blocking control in assays to test for specificity of this USP36 antibody


Western Blot analysis using USP36 antibody (70R-3767)

USP36 antibody (70R-3767) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 123 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of USP36 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes such as the one encoded by USP36.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using USP36 antibody (70R-3767) | USP36 antibody (70R-3767) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors