UST antibody (70R-1825)

Rabbit polyclonal UST antibody raised against the C terminal of UST

Synonyms Polyclonal UST antibody, Anti-UST antibody, 2OST antibody, Uronyl-2-Sulfotransferase antibody
Specificity UST antibody was raised against the C terminal of UST
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen UST antibody was raised using the C terminal of UST corresponding to a region with amino acids YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY
Assay Information UST Blocking Peptide, catalog no. 33R-10095, is also available for use as a blocking control in assays to test for specificity of this UST antibody


Immunohistochemical staining using UST antibody (70R-1825)

UST antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of UST antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UST catalyzes the transfer of sulfate to the position 2 of uronyl residues. UST has mainly activity toward iduronyl residues in dermatan sulfate, and weaker activity toward glucuronyl residues of chondroitin sulfate. It has no activity toward desulfated N-resulfated heparin.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using UST antibody (70R-1825) | UST antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using UST antibody (70R-1825) | UST antibody (70R-1825) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using UST antibody (70R-1825) | UST antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors